PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02339g10011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 139aa    MW: 15744.7 Da    PI: 5.0732
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02339g10011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.44.2e-5319114297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               reqdr+lPianv+rimk +lP nakisk+aket+qecvsefi+fvtseasdkc++e+rkt+ngdd++wal+tlGf+dy  +lk y
  Peinf101Scf02339g10011.1  19 REQDRLLPIANVGRIMKTILPPNAKISKEAKETMQECVSEFIAFVTSEASDKCRKERRKTVNGDDVCWALGTLGFDDYSGALKRY 103
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l++yre+egek
  Peinf101Scf02339g10011.1 104 LHRYREMEGEK 114
                               *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5116132IPR009072Histone-fold
SuperFamilySSF471138.54E-3921124IPR009072Histone-fold
PfamPF008081.7E-262488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-165270No hitNo description
PRINTSPR006152.2E-167189No hitNo description
PRINTSPR006152.2E-1690108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MAHQNMGASS SNDEVGVSRE QDRLLPIANV GRIMKTILPP NAKISKEAKE TMQECVSEFI  60
AFVTSEASDK CRKERRKTVN GDDVCWALGT LGFDDYSGAL KRYLHRYREM EGEKVNQERV  120
SNSEELMEEP AAQPRNYID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4419109292Transcription factor HapC (Eurofung)
4g92_B8e-4419109292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-92HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342784.17e-78PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822486e-59NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM1C2L27e-78M1C2L2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000584142e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-60nuclear factor Y, subunit B5